Skip Navigation

This Article
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Add to My Personal Archive
Right arrow Download to citation manager
Right arrow Request Permissions
Google Scholar
Right arrow Articles by OKAMURA, K.
Right arrow Articles by NISHIMURA, M.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by OKAMURA, K.
Right arrow Articles by NISHIMURA, M.
Social Bookmarking
Add to CiteULike   Add to Connotea   Add to Del.icio.us  
What's this?

J. Biochem, 1987, Vol. 101, No. 4 957-966
© 1987 Japanese Biochemical Society

other

Complete Amino Acid Sequence of Cytochrome c551 from Erythrobacter Species Strain OCh 1141

Kazuo OKAMURA2, Toshiyuki MIYATA, Sadaaki IWANAGA, Ken-ichiro TAKAMIYA and Mitsuo NISHIMURA3

Department of Biology, Faculty of Science, Kyushu University 33 Higashi-ku, Fukuoka, 812

2Present address: National Institute of Neuroscience, NCNP, Kodaira, Tokyo 187.

3To whom correspondence should be addressed.

The complete amino acid sequence of cytochrome c551 isolated from an aerobic photosynthetic bacterium, Erythrobacter sp. strain OCh 114, was determined. The cytochrome molecule was composed of a total of 119 amino acid residues and its molecular weight including heme was calculated to be 13, 235. The sequence was EGDIEAGEKAFNKCKSCHQIVSDAGEEIVKGGRTGPNLYGVLGRQAGTADFRYGDDLVAAGEAGLVWDADNFVEYVTDPRAFLRAYLDDSKAKMAYKLRSGGEDIAAYLASVSGSSS. Its molecular weight indicates that this cytochrome is of the L-type. Sequence alignment with other bacterial cytochromes c shows that this cytochrome is similar to cytochromes c of Rhodobacter capsulatus, Rhodobacter sphaeroides, and Paracoccus denitrificans which were grouped into the {alpha}-3 subcluster from the 16S rRNA sequence analysis.

1This work was supported in part by Grants-in-Aid for Scientific Research from the Ministry of Education, Science and Culture of Japan.


Add to CiteULike CiteULike   Add to Connotea Connotea   Add to Del.icio.us Del.icio.us    What's this?




Disclaimer: Please note that abstracts for content published before 1996 were created through digital scanning and may therefore not exactly replicate the text of the original print issues. All efforts have been made to ensure accuracy, but the Publisher will not be held responsible for any remaining inaccuracies. If you require any further clarification, please contact our Customer Services Department.