Skip Navigation

This Article
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Add to My Personal Archive
Right arrow Download to citation manager
Right arrow Request Permissions
Google Scholar
Right arrow Articles by Takahashi, K.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Takahashi, K.
Social Bookmarking
Add to CiteULike   Add to Connotea   Add to Del.icio.us  
What's this?

J. Biochem, 1988, Vol. 104, No. 3 375-382
© 1988 Japanese Biochemical Society

research-article

The Amino Acid Sequence of Ribonuclease N1, a Guanine-Specific Ribonuclease from the Fungus Neurospora crassa1

Kenji Takahashi

Department of Biophysics and Biochemistry, Faculty of Science, The University of Tokyo Bunkyo-ku, Tokyo 113

The complete amino acid sequence of ribonuclease N1 (RNase N1 a guanine-specific ribonuclease from a fungus, Neurospora crassa, was determined by conventional protein sequencing, using peptide fragments obtained by tryptic digestion of cyanogen bromidetreated RNase N1 and by Staphylococcus aureus V8 protease digestion of heat-denatured RNase N1 The results showed that the protein is composed of a single polypeptide chain of 104 amino acid residues cross-linked by two disulfide bonds and has a molecular weight of 11,174:

ACMYICGSVCYSSSSISAALNKGYSYYEDGATAGSSSYPHRYNNYEGFDFPTAKPWYE FPILSSGRVYTGGSPGADRVIFDSHGNLDMLITHNGASGNNFVACN

(Disulfide bonds: C2-C10, C6-C103)

The amino acid sequence was homologous with those of RNase T1 (65% identity) and related microbial RNases.

1This study was supported in part by Grants.in-Aid for Scientific Research from the Ministry of Education, Science, and Culture of Japan.


Add to CiteULike CiteULike   Add to Connotea Connotea   Add to Del.icio.us Del.icio.us    What's this?




Disclaimer: Please note that abstracts for content published before 1996 were created through digital scanning and may therefore not exactly replicate the text of the original print issues. All efforts have been made to ensure accuracy, but the Publisher will not be held responsible for any remaining inaccuracies. If you require any further clarification, please contact our Customer Services Department.